PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00131.37
Common NameAMTR_s00131p00063460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 467aa    MW: 51570.7 Da    PI: 6.1929
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00131.37genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.64.5e-31262316155
                                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                              k+r+rWt+eLHe+Fv+av+ LGG+++AtPk+il++m+v gL ++hvkSHLQkYRl
  evm_27.model.AmTr_v1.0_scaffold00131.37 262 KTRMRWTQELHEQFVKAVTFLGGPDVATPKSILRIMNVAGLNIYHVKSHLQKYRL 316
                                              68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.48E-17259317IPR009057Homeodomain-like
PROSITE profilePS5129412.515259319IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-29261318IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-23262317IPR006447Myb domain, plants
PfamPF002496.0E-8264315IPR001005SANT/Myb domain
PfamPF143791.5E-13356399IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MYHKVFAYQA SPFGCNQKEM NEEYCKCGKQ CGSLQAPLVS FSTSKVASYG QSSAPSSLCN  60
TREQPLTPLE DLSVAAGETT CAYSFSLSPN LRNMCSQSSM FCPSLHSSHK EFQIGNIPFL  120
PYPQISDHPV SSSQSLKFML LGHGDSSLYQ YKECNNLENS MNDDDNVSPQ DASGCNLVGQ  180
SCRGSVMTSE QADWQVVADP TGLVITNNCE DSMLDEFFVA TKGSSSNTIG FQGNHMDGQF  240
VFPIGEQLNT GPLTSRNGTV NKTRMRWTQE LHEQFVKAVT FLGGPDVATP KSILRIMNVA  300
GLNIYHVKSH LQKYRLARYQ PGNGEDKRSP GSETKKKSSA DTDKENVYVK MGAQDTEYLR  360
LQLEVQKKLH KQLEEQRELQ LWIEANARSL QKMVEEQHRA LIHATLSLSS SSPLASTSEL  420
KDNSEPCRPP CFGLTNKEGL SSMETDDGST LELEIHSSAS KRARME*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011620874.10.0PREDICTED: uncharacterized protein LOC18427451
TrEMBLW1NR410.0W1NR41_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.26e-50G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]